DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gr59f

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:148 Identity:32/148 - (21%)
Similarity:56/148 - (37%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IWDSHAIIGY----LVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENAT 125
            || :|..:.|    .:|.|...:.:......:..::.|.:.:....|..|:.::|.. |.....:
  Fly   172 IW-THKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELTH-LHSPRIS 234

  Fly   126 EVPKDRL--AELKD---------AYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPV- 178
            ||.|.|:  |.|.|         .|::|..|:.          ...:|::|     |.|.|..: 
  Fly   235 EVQKIRMHHANLIDFTKAVNRTFQYSILLLFVG----------CFLNFNLV-----LFLVYQGIE 284

  Fly   179 -----DATKYPKLSAWLA 191
                 |.||:..:..|||
  Fly   285 NPSMADFTKWVCMLLWLA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 32/148 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 4/15 (27%)
GST_C_Delta_Epsilon 91..211 CDD:198287 26/118 (22%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 32/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.