DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GstE2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:205 Identity:112/205 - (54%)
Similarity:144/205 - (70%) Gaps:2/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68
            |:|||.:.||||||..||||||.||:|:..:|:.||||.|...|:||||||||:|||..:.||||
  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69

  Fly    69 HAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLA 133
            |||:.|||:|||.||||||:|.:.||.|||||.|:..:||..: :.:....|....:.|||:::.
  Fly    70 HAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSL-RNVSIPYFLRQVSLVPKEKVD 133

  Fly   134 ELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPF 198
            .:||||..||.||.:|||:.|.||||||....||.|:| .:...:|..||||::||..|:|.||.
  Fly   134 NIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSL-AAVLDLDELKYPKVAAWFERLSKLPH 197

  Fly   199 YEEDNLRGAR 208
            ||||||||.:
  Fly   198 YEEDNLRGLK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 102/192 (53%)
GST_N_Delta_Epsilon 4..77 CDD:239343 46/72 (64%)
GST_C_Delta_Epsilon 91..211 CDD:198287 55/118 (47%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 102/192 (53%)
GST_N_Delta_Epsilon 5..78 CDD:239343 46/72 (64%)
GST_C_Delta_Epsilon 94..209 CDD:198287 55/116 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467981
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.