DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and clic4

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:107 Identity:27/107 - (25%)
Similarity:37/107 - (34%) Gaps:31/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PDMLRKNPQHTVP----MLEDGE-----SCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQR 99
            ||.:..|....|.    |..|||     .|                   .|.||..:.:.|..:.
Zfish   159 PDEIDHNSMEEVKASTRMFLDGEEMTLADC-------------------NLLPKLHIVKVVAKKY 204

  Fly   100 LHFETGVLFHGIFKQLQRALFKENATEV-PKDRLAELKDAYA 140
            ..||......||::.|..|..:|..|.. |.|:  |::.|||
Zfish   205 RGFEIPKDLTGIWRYLNNAYKREEFTNTCPSDK--EIEIAYA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 27/107 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/41 (22%)
GST_C_Delta_Epsilon 91..211 CDD:198287 15/51 (29%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359
O-ClC 16..250 CDD:129941 27/107 (25%)
GST_C_CLIC4 110..250 CDD:198329 27/107 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.