DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GstT4

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:98/237 - (41%) Gaps:37/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQ--HTVPMLEDGESCIWDSHAIIGYLVNK 78
            ||:.:.|.|.::..|...:.|..|:||..: .|.|..  ..:|.:.|....:.::.||..:|..:
  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGE-FRDNVNRFRKLPAITDHGYQLSENVAIFRHLARE 80

  Fly    79 YAQSDELYPKDPLKRAVVDQRLHFE---TGVLFHGIFKQ------LQRALFKENATEVPKDRLAE 134
            ....:..||:..|.|:.:|:.|.::   .||.....|:|      ||:....:||..:...:|..
  Fly    81 KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEH 145

  Fly   135 LKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFY 199
            ..:.:..|  ||....::.|..::.||.|.:          |.:|..|....:|:..|.....:|
  Fly   146 TLNEFEQL--FLNSRKFMMGDNISYADLSAI----------CEIDQPKSIGYNAFQNRNKLARWY 198

  Fly   200 EEDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIK-SGAGKQ 240
            |            .:|.:|...:.::..:....:| ||:|:|
  Fly   199 E------------TVREELGPHYKEVLGEFEAKLKGSGSGQQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/191 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/62 (26%)
GST_C_Delta_Epsilon 91..211 CDD:198287 27/128 (21%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 16/63 (25%)
GST_C_Theta 95..220 CDD:198292 28/148 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.