DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Clic6

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:215 Identity:43/215 - (20%)
Similarity:79/215 - (36%) Gaps:71/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TLDMQAGDHLKPDMLRKNPQHTVP--MLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAV 95
            |:|::.    ||..|:.....|.|  |..||| ...|.:.|..:|..|..  ...|||...:   
  Rat   417 TVDLKR----KPADLQNLAPGTNPPFMTFDGE-VKTDVNKIEEFLEEKLV--PPRYPKLGTQ--- 471

  Fly    96 VDQRLHFETGVLFHGIFKQLQRAL--FKENATEV-PKDRLAELK--------------DAYALLE 143
                 |.|:....:.:|.:....:  .|::|.:: .|:.|..||              |||:..:
  Rat   472 -----HPESNSAGNDVFAKFSAFIKNTKKDANDIYEKNLLRALKKLDSYLNSPLPDEIDAYSTED 531

  Fly   144 QFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGAR 208
            ..:::..::.|.:||:||.:::                  |||..                  .:
  Rat   532 VTVSQRKFLDGDELTLADCNLL------------------PKLHI------------------IK 560

  Fly   209 LLADKIRS-KLPKQFDKLWQ 227
            ::|.|.|. :.|.:...:|:
  Rat   561 IVAKKYRGFEFPSEMTGIWR 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 38/182 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/45 (31%)
GST_C_Delta_Epsilon 91..211 CDD:198287 20/136 (15%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 43/215 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.