DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Mars1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006241513.1 Gene:Mars1 / 299851 RGDID:1305321 Length:910 Species:Rattus norvegicus


Alignment Length:268 Identity:59/268 - (22%)
Similarity:100/268 - (37%) Gaps:102/268 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLE-DGESCIWDSHAIIGY-----------LVNKYA--QSDELYP----------------KD 89
            ||:|: |..:.::.:.||..|           |.|::.  ::.||.|                :|
  Rat    48 VPVLQLDSGNYLFSASAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSAALYCLVVQGKKGED 112

  Fly    90 ---PLKRAV--VD-----QRLHFETG--------VLFHGIFKQLQ------------RALFKENA 124
               ||:|.:  :|     |...|..|        ||:..::..||            ::.|:..:
  Rat   113 VLGPLRRVLTHIDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQDPAYLPEELGALQSWFQTLS 177

  Fly   125 TEVPKDRLAELKDAYALLEQ--FLAENPYV---AGPQ------------------LTIADFSIVA 166
            |:.|..|.||     .:|:|  .||..||:   ..||                  .|:::..|:|
  Rat   178 TQEPCQRAAE-----TVLKQQGVLALRPYLQKQPQPQPLPPEGRAVSNEPEEEELATLSEEDIIA 237

  Fly   167 TVSTLHL---SYCPVDATKYPKLSAWLAR----ISALPFYEE----DNLRGARLLADKIR--SKL 218
            .|:....   :..|:...::|.|.....|    .||||:...    .|:.|..|.||...  |:|
  Rat   238 AVAAWEKGLENLPPLQPQQHPVLPVPGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL 302

  Fly   219 PKQFDKLW 226
             :|::.|:
  Rat   303 -RQWNTLY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 48/231 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 8/33 (24%)
GST_C_Delta_Epsilon 91..211 CDD:198287 39/180 (22%)
Mars1XP_006241513.1 Thioredoxin_like 1..68 CDD:294274 6/19 (32%)
GstA <47..189 CDD:223698 30/145 (21%)
GST_C_MetRS_N 77..179 CDD:198340 18/101 (18%)
PRK12268 266..821 CDD:237029 14/45 (31%)
MetRS_core 267..635 CDD:173907 13/44 (30%)
Anticodon_Ia_Met 644..773 CDD:153411
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.