DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Clic4

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:115 Identity:27/115 - (23%)
Similarity:44/115 - (38%) Gaps:37/115 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYP-----------KL 186
            :|:|.....:|:||.|               ::.....|.||      .|:|           |.
Mouse    82 SEVKTDVNKIEEFLEE---------------VLCPPKYLKLS------PKHPESNTAGMDIFAKF 125

  Fly   187 SAWL--ARISALPFYEEDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIK 234
            ||::  :|..|....|...|:..:.|.:.:.|.||.:.|   :.:.||||
Mouse   126 SAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEID---ENSMEDIK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 16/76 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..211 CDD:198287 18/90 (20%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 6/33 (18%)
O-ClC 17..252 CDD:129941 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.