DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTM5

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_000842.2 Gene:GSTM5 / 2949 HGNCID:4637 Length:218 Species:Homo sapiens


Alignment Length:143 Identity:37/143 - (25%)
Similarity:61/143 - (42%) Gaps:30/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQL 115
            :|.|.||...|..|:||:.|:..|:    ...:|....|.|:..|:|..:             :|
Human    60 LPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHM-------------EL 111

  Fly   116 QRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDA 180
            .|..:..:..::....|.||.:...|..:||.:.|:.||.::|..||          |:|..:|.
Human   112 VRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDF----------LAYDVLDM 166

  Fly   181 TKY--PK-LSAWL 190
            .:.  || |.|:|
Human   167 KRIFEPKCLDAFL 179

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 37/143 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/21 (43%)
GST_C_Delta_Epsilon 91..211 CDD:198287 25/103 (24%)
GSTM5NP_000842.2 GST_N_Mu 3..84 CDD:239373 9/23 (39%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08515 7..8
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08515 46..50
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08515 59..60 37/143 (26%)