DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTM1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_000552.2 Gene:GSTM1 / 2944 HGNCID:4632 Length:218 Species:Homo sapiens


Alignment Length:171 Identity:46/171 - (26%)
Similarity:81/171 - (47%) Gaps:25/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLHFETGVL-FHGIFKQ 114
            :|.|.||...|..|:||:.|:..|:    ...:|....|.|:...:|.  |.:.|:: ::..|::
Human    60 LPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDN--HMQLGMICYNPEFEK 122

  Fly   115 LQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVD 179
            |:           || .|.||.:...|..:||.:.|:.||.::|..|| :|..|..||..:.|..
Human   123 LK-----------PK-YLEELPEKLKLYSEFLGKRPWFAGNKITFVDF-LVYDVLDLHRIFEPKC 174

  Fly   180 ATKYPKLSAWLARISALPFYEEDN--LRGARLLADKIRSKL 218
            ...:|.|..:::|...|   |:.:  ::.:|.|...:.||:
Human   175 LDAFPNLKDFISRFEGL---EKISAYMKSSRFLPRPVFSKM 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 40/146 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/21 (43%)
GST_C_Delta_Epsilon 91..211 CDD:198287 31/122 (25%)
GSTM1NP_000552.2 GST_N_Mu 3..84 CDD:239373 9/23 (39%)
Glutathione binding. /evidence=ECO:0000269|Ref.20, ECO:0000305|PubMed:16548513 7..8
Glutathione binding. /evidence=ECO:0000269|Ref.20, ECO:0000305|PubMed:16548513 43..46
Glutathione binding. /evidence=ECO:0000269|Ref.20, ECO:0000305|PubMed:16548513 59..60 46/171 (27%)