DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Clic2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:276 Identity:49/276 - (17%)
Similarity:92/276 - (33%) Gaps:111/276 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLILYGTESSPPVRA---------------------VLLTLRALQLDHEFHTLDMQAGDHLKP 44
            ||:|.| .|::.|.:..                     ::|.|:.::.:  ..|:|...    ||
  Rat     1 MASLAL-NTQADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFN--VTTIDTAR----KP 58

  Fly    45 DMLR-----KNPQHTVPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRL---- 100
            :.|:     .||    |.|                :.||..::|.:..::.|::.:...|.    
  Rat    59 EELKDLAPGTNP----PFL----------------IYNKELKTDFIKIEEFLEKTLAPPRYPHLS 103

  Fly   101 -----HFETGVLFHGIFKQLQRALFKENATEVPKDRLAELK--------------DAYALLEQFL 146
                 .|:.|......|....:...||......|..|.|.|              |..:..|:.|
  Rat   104 PKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTL 168

  Fly   147 AENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGARLLA 211
            :...::.|.|||:||.|::                  |||:  :.:::|..:.:.|         
  Rat   169 SRRLFLDGDQLTLADCSLL------------------PKLN--IIKVAAKKYRDFD--------- 204

  Fly   212 DKIRSKLPKQFDKLWQ 227
                  :|.:|..:|:
  Rat   205 ------IPAEFSGVWR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/241 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/98 (15%)
GST_C_Delta_Epsilon 91..211 CDD:198287 26/142 (18%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 21/121 (17%)
GST_N_CLIC 9..99 CDD:239359 16/115 (14%)
O-ClC 12..245 CDD:129941 44/264 (17%)
GST_C_CLIC2 106..244 CDD:198331 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.