DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Eef1g

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:219 Identity:54/219 - (24%)
Similarity:85/219 - (38%) Gaps:47/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLE-DGESCIWDSHAIIGYLVNKYAQSDEL 85
            :|.|.....||.    ...:..|:.|||.|...||..| |...|:::|:||..|:.|     :||
  Rat    29 IRVLSAPPHFHF----GQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSN-----EEL 84

  Fly    86 YPKDPLKRAVVDQRLHF---------------ETGVLFHGIFKQLQRALFKENATEVPKDRLAEL 135
            ....|...|.|.|.:.|               ..|::.|           .:.|||..|:   |:
  Rat    85 RGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH-----------NKQATENAKE---EV 135

  Fly   136 KDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYC-PVDATKYPKLSAWLARISALPFY 199
            |....||:..|....::.|.::|:||.::|.|:..|:.... |.....:|..:.|.......|.:
  Rat   136 KRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQF 200

  Fly   200 EEDNLRGARLLADKIRSKLPKQFD 223
            ..  :.|...|.:|:     .|||
  Rat   201 RA--ILGEVKLCEKM-----AQFD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 47/191 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/55 (33%)
GST_C_Delta_Epsilon 91..211 CDD:198287 27/135 (20%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 19/61 (31%)
maiA 5..187 CDD:273527 46/180 (26%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 28/137 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.