DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTT4

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:208 Identity:57/208 - (27%)
Similarity:96/208 - (46%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68
            |.||....|.|.|||.:..:...:...|..:|:..|.|.....:..||...:|.|:||:..:.:|
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    69 HAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFK-------QLQRALFKENATE 126
            .||:.||..||:......|.||..||.||:.:.::     |..|:       .|:..:.|....|
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQ-----HTAFQLPMKKIVWLKLLIPKITGEE 127

  Fly   127 VPKDRL----AELKDAYALLEQ-FLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKY--- 183
            |..:::    .|:|::..|.|: ||.:..::.|.|:::||  :||.|..:.    |: |..|   
Human   128 VSAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLAD--LVAVVEMMQ----PM-AANYNVF 185

  Fly   184 ---PKLSAWLARI 193
               .||:.|..::
Human   186 LNSSKLAEWRMQV 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 57/208 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 91..211 CDD:198287 29/121 (24%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 23/74 (31%)