DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gst2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:238 Identity:65/238 - (27%)
Similarity:92/238 - (38%) Gaps:65/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLED---GE 62
            ||:..||.....|....|:|.|:.|.|.:|....|.|.|:....:.|..||...||.|.|   .:
pombe     1 MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNND 65

  Fly    63 SCIWDSHAIIGYLVNKYAQSD---ELYPKDPLKRAVVDQRLHFET---GVL---------FHGIF 112
            ..||:|.||:.||.:|| .:|   .|...||....:: |.|.|:.   ||:         ||   
pombe    66 YTIWESDAILIYLADKY-DTDRKISLSFDDPEYYKLI-QYLFFQASGQGVIWGQAGWFNFFH--- 125

  Fly   113 KQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCP 177
                   .:...:.|.:.| .|:|....:||..|.:..|:...:.||||           ||:.|
pombe   126 -------HEPVVSAVTRYR-NEIKRVLGVLEDILKDRDYLVANKYTIAD-----------LSFIP 171

  Fly   178 ----------------------VDATK-YPKLSAWLARISALP 197
                                  :|..| :||..||..|:.|.|
pombe   172 WNYNLGGLFGEGKFSFKEEVPQLDFEKEFPKAYAWNQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 62/233 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/75 (35%)
GST_C_Delta_Epsilon 91..211 CDD:198287 31/142 (22%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 28/80 (35%)
GstA 5..226 CDD:223698 63/234 (27%)
GST_C_Ure2p 96..219 CDD:198326 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.