DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gst1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:218 Identity:56/218 - (25%)
Similarity:92/218 - (42%) Gaps:25/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLED---GE 62
            ||...|:.....|....|:..|:.|.|.:|...::....:...|:.|..||...||.|.|   .:
pombe     1 MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNND 65

  Fly    63 SCIWDSHAIIGYLVNKYAQSDEL-YPKDPLKRAVVDQRLHFET---GVLF--HGIFKQLQRALFK 121
            ..||:|.||:.||.:||....:: .|:|..:...|.|.|.|:.   |:::  .|.|....:.|..
pombe    66 YTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVI 130

  Fly   122 ENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYC---------- 176
            ...|....    |:|....:||..|.:..|:...:.||||.|.::..:.|.:.:.          
pombe   131 SAITRYRN----EIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEV 191

  Fly   177 -PVDATK-YPKLSAWLARISALP 197
             .:|..| :|:..:|..|:.|.|
pombe   192 PQLDFEKEFPRTYSWHQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 53/213 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/75 (29%)
GST_C_Delta_Epsilon 91..211 CDD:198287 28/124 (23%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 24/80 (30%)
GstA 5..218 CDD:223698 54/214 (25%)
GST_C_Ure2p 96..219 CDD:198326 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.