DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and AIMP3

DIOPT Version :10

Sequence 1:NP_611322.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:60 Identity:21/60 - (35%)
Similarity:27/60 - (45%) Gaps:6/60 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KDAYA---LLEQF---LAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAW 189
            ||.|.   ||..|   .|...|:.|..:|:||.::...:..|..|..|||...|..||.|
  Fly    87 KDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRW 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_611322.1 GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..211 CDD:198287 21/60 (35%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.