DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gstm2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_803175.1 Gene:Gstm2 / 24424 RGDID:2756 Length:218 Species:Rattus norvegicus


Alignment Length:174 Identity:46/174 - (26%)
Similarity:72/174 - (41%) Gaps:23/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQL 115
            :|.|.||...|..|:||:.||..|:    ...:|....|.|:...:|.||             ||
  Rat    60 LPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDVLENQAMDTRL-------------QL 111

  Fly   116 QRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDA 180
            ....:..:......:.|..|.:...|..:||.:.|:.||.::|..|| :|..|...|..:.|...
  Rat   112 AMVCYSPDFERKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKITYVDF-LVYDVLDQHRIFEPKCL 175

  Fly   181 TKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKL----PK 220
            ..:|.|..::||...|... .|.::..|.|:..|.:|:    ||
  Rat   176 DAFPNLKDFVARFEGLKKI-SDYMKSGRFLSKPIFAKMAFWNPK 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 38/145 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/21 (48%)
GST_C_Delta_Epsilon 91..211 CDD:198287 28/119 (24%)
Gstm2NP_803175.1 PTZ00057 3..200 CDD:173353 40/154 (26%)
GST_N_Mu 3..84 CDD:239373 10/23 (43%)
Glutathione binding. /evidence=ECO:0000305|PubMed:8664265 7..8
Glutathione binding. /evidence=ECO:0000305|PubMed:8664265 43..46
Glutathione binding. /evidence=ECO:0000305|PubMed:8664265 59..60 46/174 (26%)