DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:245 Identity:52/245 - (21%)
Similarity:88/245 - (35%) Gaps:51/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWD 67
            :|:||....|...:.|.|.:....|..|...:.:...:|.:|..:|.|....||::...::.|.|
Mouse    46 SLVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISD 110

  Fly    68 SHAIIGYLVNKYAQSD--ELYPK--DPLKRAVVDQRLHFET---GVLFHGIFKQLQRALFKENAT 125
            ...||.|:...:....  .|.|:  .|....|:..|...:.   ....||..      |..|..|
Mouse   111 YDQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCI------LHPELTT 169

  Fly   126 E--VPKDRLAELKDAYA-----LLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKY 183
            :  :||...||::...|     |::....|.|.::.|.|                       :|.
Mouse   170 DSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYL-----------------------SKQ 211

  Fly   184 PKLSAWLARISALPFYEEDNLRGARLLADKIRSKLPK-------QFDKLW 226
            .||.|.:.....:. |.:..|....::.|:|.::|.|       |..:||
Mouse   212 KKLMAKILEHDDVS-YLKKILGELAMVLDQIEAELEKRKLENEGQTCELW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/206 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 91..211 CDD:198287 23/129 (18%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 52/244 (21%)
GST_N_GDAP1 47..119 CDD:239350 19/71 (27%)
GST_C_family 201..311 CDD:295467 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.