DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Clic5

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:315 Identity:61/315 - (19%)
Similarity:91/315 - (28%) Gaps:138/315 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DMQAGD----HLKPDMLRKNPQHT-------VP----MLEDGESCIWD--------------SHA 70
            |:..||    ...|:.|...||..       ||    :.:|.|...|:              ||:
Mouse    93 DVSMGDSHSPSQDPEPLSWEPQENGGATEEDVPSSHSLSQDPERLPWEPQENGGATEEDVPSSHS 157

  Fly    71 IIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALF--KEN--ATE--VP- 128
            :        :|..|..|.:|.:.....:    |.....|.:.:.|:|..:  :||  |||  || 
Mouse   158 L--------SQDLERLPWEPQENGGATE----EDVSSSHSLSQDLERLPWEPQENGGATEEDVPS 210

  Fly   129 ---------------KDRLAELKDAYALLEQ---------FLAENPYVAGPQLTIADFS------ 163
                           :|....|..|..|.|:         ||.....:.|..:....||      
Mouse   211 LLSFRVQHSKVLATSQDSSISLSAAIGLGEKEAASSNPEIFLFVKAGIDGESIGNCPFSQRLFMI 275

  Fly   164 -----IVATVSTLHLSYCPVD-----------------------------------ATKYPKLSA 188
                 :|..|:|:.|...|.|                                   ..|||||:|
Mouse   276 LWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAA 340

  Fly   189 -----------WLARISAL---------PFYEEDNLRGARLLADKIRSKLPKQFD 223
                       ..::.||.         ...|....:..|.|.|.:.|.||::.|
Mouse   341 KHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEID 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 53/287 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/70 (20%)
GST_C_Delta_Epsilon 91..211 CDD:198287 37/216 (17%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.