DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Clic6

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:208 Identity:46/208 - (22%)
Similarity:76/208 - (36%) Gaps:52/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQAGDHL-KPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQR 99
            :|.|:.| :.:..|:|.    |.||:|:.  ...|.|..::       ...|..:.:......||
Mouse   333 VQGGEELGRVNGRRENG----PALEEGDP--GQEHDITLFV-------KAGYDGESIGNCPFSQR 384

  Fly   100 LH---FETGVLFHGIFKQLQRALFKENATEVPKD--RLA------------ELKDAYALLEQFLA 147
            |.   :..||:|:.....|:|.         |.|  .||            |:|.....:|:||.
Mouse   385 LFMILWLKGVIFNVTTVDLKRK---------PADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLE 440

  Fly   148 ENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWL--ARISALPFYEEDNLRGARLL 210
            |.  :..|:        ...:.|.|..........:.|.||::  .:..|...||::.||..:.|
Mouse   441 EK--LVPPR--------YPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLRALKKL 495

  Fly   211 ADKIRSKLPKQFD 223
            ...:.|.||.:.|
Mouse   496 DSYLNSPLPDEID 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 37/180 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 11/41 (27%)
GST_C_Delta_Epsilon 91..211 CDD:198287 29/138 (21%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360 9/32 (28%)
PHA02664 <69..167 CDD:177447
GST_N_CLIC 360..448 CDD:239359 22/113 (19%)
O-ClC 363..596 CDD:129941 36/172 (21%)
GST_C_CLIC6 455..594 CDD:198334 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.