DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gst-43

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:234 Identity:60/234 - (25%)
Similarity:94/234 - (40%) Gaps:49/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHL-KPDMLRKNPQHTVPMLEDGESC 64
            ||..|||....|.....|.:.|....:|:|:..:|:.:.:.. ..:.::.||...||.|......
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLS 65

  Fly    65 IWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPK 129
            :.:|.|||.||       ||.||..|.....:|:| .:...:..| |...:|..    .|..:.|
 Worm    66 LTESLAIIEYL-------DEAYPDPPFLPKELDKR-SYSRAIALH-IVASIQPL----QAINIHK 117

  Fly   130 DRLAELKDAYA-------------LLEQFLAEN--PYVAGPQLTIADFSIVATVSTLHLSYCPVD 179
             .|.|.:..|.             .||:.|.::  .|..|.||||||.::.:.:  .:.....||
 Worm   118 -MLNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSII--YNAKIYKVD 179

  Fly   180 ATKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKL 218
            .:|||.::    ||:             .:||:..|.||
 Worm   180 MSKYPTIT----RIN-------------EILAEDFRFKL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 53/208 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 91..211 CDD:198287 28/134 (21%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 20/79 (25%)
maiA 5..211 CDD:273527 58/230 (25%)
GST_C_Zeta 90..207 CDD:198300 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.