DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:217 Identity:53/217 - (24%)
Similarity:87/217 - (40%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIW 66
            |..|||.:.||.....|...|...::|:|:..::: .....:.:....||...||:|:.....:.
 Worm     3 AKPILYSSWSSGCSSRVRTALALKKIDYEYQPVNL-LNKQKEQEFHGNNPAEKVPILKINGLTLT 66

  Fly    67 DSHAIIGYLVNKYAQSDELYPKDPL--KRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPK 129
            :|.|||.||       ||:||..||  |...:..|..   .:.|| |...:|....|      |.
 Worm    67 ESMAIIEYL-------DEIYPDPPLLPKEPELKARAR---AIAFH-IASNIQPLQNK------PI 114

  Fly   130 DRLAELKD--------------AYALLEQFLA--ENPYVAGPQLTIADFSIVATVSTLHLSYCPV 178
            ..:...|:              .:..||:.|.  ...:..|.|::|||..:.:.|......| .|
 Worm   115 YLMLNEKEPGYGDFWCQHFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAIEKY-HV 178

  Fly   179 DATKYPKLSAWLARISALPFYE 200
            |.|.||.::....:::.||.::
 Worm   179 DMTPYPIITRISNKLAELPEFQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 50/210 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..211 CDD:198287 27/128 (21%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 20/78 (26%)
maiA 18..211 CDD:273527 47/202 (23%)
GST_C_Zeta 89..207 CDD:198300 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163431
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.