Sequence 1: | NP_001286570.1 | Gene: | GstE10 / 37105 | FlyBaseID: | FBgn0063499 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497118.1 | Gene: | gst-29 / 190225 | WormBaseID: | WBGene00001777 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 61/199 - (30%) |
---|---|---|---|
Similarity: | 95/199 - (47%) | Gaps: | 30/199 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VRAVLLTLRALQLDHEFHTLDMQAGDHLKP------DMLR-KNPQHTVPML-EDGESCIWDSHAI 71
Fly 72 IGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPK---DRLA 133
Fly 134 ELKDAY-----ALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARI 193
Fly 194 SALP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE10 | NP_001286570.1 | GstA | 4..197 | CDD:223698 | 60/197 (30%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 25/69 (36%) | ||
GST_C_Delta_Epsilon | 91..211 | CDD:198287 | 34/115 (30%) | ||
gst-29 | NP_497118.1 | GST_N_Sigma_like | 4..74 | CDD:239337 | 24/68 (35%) |
PTZ00057 | 6..209 | CDD:173353 | 61/199 (31%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 31/113 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |