DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gst-14

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:216 Identity:56/216 - (25%)
Similarity:89/216 - (41%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PVRAVLLTLRALQLDHEFHTLDMQAG-----------DHLKPDMLRKNPQHTVPMLEDGESCIWD 67
            |||.:..:.|.|     ||.    ||           |.....|..|.|...:|:|...:..|..
 Worm    10 PVRGLAESARLL-----FHL----AGVPFEDERVNFLDDTWEKMKGKTPMGQLPVLTVDDFEIPQ 65

  Fly    68 SHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFK----ENATEVP 128
            |.||..||..|:..:.:...::....|||||         |...|.:.::.:..    ::|.|:.
 Worm    66 SAAINRYLARKFGFAGKTPEEEAWVDAVVDQ---------FKDFFAEFRKLVIAKRVGKSAEELE 121

  Fly   129 KDRLAELK---DAY-----ALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDAT-KYP 184
            |.....:|   |.|     .|||:  :::.|:.|..:|.||..|...:.||. .|..::|: :.|
 Worm   122 KLTAEVIKPAMDVYFKVLNGLLEK--SKSGYLIGDSITFADLYIADNIQTLK-KYGLLEASGEQP 183

  Fly   185 KLSAWLARISALPFYEEDNLR 205
            ||:|.|.::     |...||:
 Worm   184 KLAAHLEKV-----YSHPNLK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 53/206 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/73 (29%)
GST_C_Delta_Epsilon 91..211 CDD:198287 34/128 (27%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 21/73 (29%)
PTZ00057 6..205 CDD:173353 56/216 (26%)
GST_C_Sigma_like 85..192 CDD:198301 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.