DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gst-24

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:192 Identity:50/192 - (26%)
Similarity:87/192 - (45%) Gaps:27/192 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDH-EFHTLDMQAG----DHLKPDMLRKNPQHTVPMLE-DGESCIWDSHAIIGYLVNKYAQSDE 84
            :|.| ||..:.::.|    ..|||    |.|...:|.|. ||.. |..|.||:.||..|:..:.:
 Worm    23 KLAHVEFEDVRIENGTPEWGALKP----KTPFGQLPFLSVDGFE-IPQSAAILRYLAKKFGYAGK 82

  Fly    85 LYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATE---VPKDRLAELKDAY-----AL 141
            ...::....|:|||...|.|.:      :||..|....||.|   :.|:..|..:|.:     .:
 Worm    83 TSEEEAWVDAIVDQFKDFVTPL------RQLIMAQRSGNAEEIERIQKEVFAPARDTFFKILNGI 141

  Fly   142 LEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDN 203
            ||:  :::.::.|..:|.||..|...::|:.:........:..||:|...:::.:|..:|.|
 Worm   142 LEK--SKSGFLVGDGVTWADLVIADILTTMEMLGVFDKHGEEQKLAALREKVNEIPEIKEHN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 47/184 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/56 (36%)
GST_C_Delta_Epsilon 91..211 CDD:198287 29/121 (24%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 20/56 (36%)
PTZ00057 6..208 CDD:173353 50/192 (26%)
GST_C_Sigma_like 85..191 CDD:198301 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.