DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and eef-1G

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_505800.1 Gene:eef-1G / 179522 WormBaseID:WBGene00008920 Length:398 Species:Caenorhabditis elegans


Alignment Length:239 Identity:53/239 - (22%)
Similarity:95/239 - (39%) Gaps:40/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHA 70
            |||.:.:...:.||:   |.:|.::..||   |||....|   |.|....|..| |::.::.:.:
 Worm     5 LYGNKDNFRTQKVLI---AAKLANKTVTL---AGDAAPAD---KFPLGVTPAFE-GDALLFGAES 59

  Fly    71 IIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHG----IFKQLQRALFKENATEVPKDR 131
            |..:|....|.::.:            |.|.|..|.|...    :...:..|.|.:...|..|: 
 Worm    60 IGLHLTGTSANAETV------------QWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKN- 111

  Fly   132 LAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATK-YPKLSAWLARISA 195
              ||.....:|::.|.:..|:.|.:|::||.|:...:..........:|.| ...::.|...:..
 Worm   112 --ELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVN 174

  Fly   196 LPFYEEDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIKSGAGK 239
            .|..:|  :.|...||..:     .||:   |..|.::.:...|
 Worm   175 QPAVKE--VLGEVSLASSV-----AQFN---QAKFTELSAKVAK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/195 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/70 (29%)
GST_C_Delta_Epsilon 91..211 CDD:198287 25/124 (20%)
eef-1GNP_505800.1 GST_N_EF1Bgamma 3..77 CDD:239342 22/93 (24%)
GstA 4..181 CDD:223698 45/202 (22%)
GST_C_EF1Bgamma_like 71..188 CDD:198290 25/133 (19%)
EF1G 238..343 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.