DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gst-27

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:180 Identity:50/180 - (27%)
Similarity:83/180 - (46%) Gaps:20/180 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLE-DGESCIWDSHAIIGYLVNKYAQSDELYPKDPL 91
            |..|....|..||....::..|.|....|:|. ||.. |..|.||..||..::..:.:...:...
 Worm    26 DVPFEDFRMTIGDGTWENLKAKTPFGQAPVLSVDGFE-IPQSAAINRYLAKQFGYAGKTPEEQAW 89

  Fly    92 KRAVVDQRLHFETGVLFHGIFKQLQRA-LFKENATEVPK---DRLAELKDA-YALLEQFL--AEN 149
            ..|:|||...|...:      |::.:| ...::|.||.|   ..|...:|| :.::.:.|  :::
 Worm    90 TDAIVDQYKDFMVSI------KEVGKASAAGKSAEEVGKIIQSDLVPARDAFFVIINKILEKSKS 148

  Fly   150 PYVAGPQLTIADFSIVATVSTL--HLSYCPVDATKYPKLSAWLARISALP 197
            .::.|..|||||..||..::||  |..:   .|::.|||.|...::.|:|
 Worm   149 GFLVGDGLTIADIVIVECITTLDKHQLF---TASEQPKLVALREKVYAIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 49/178 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/49 (35%)
GST_C_Delta_Epsilon 91..211 CDD:198287 33/116 (28%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 17/49 (35%)
PTZ00057 6..208 CDD:173353 50/180 (28%)
GST_C_Sigma_like 85..191 CDD:198301 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.