DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and exl-1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:118 Identity:31/118 - (26%)
Similarity:43/118 - (36%) Gaps:34/118 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VNKYAQSDELYPKDPLKRAVVDQRLHFETGVL--FHGIFKQLQRALFKENATEVPKDR---LAEL 135
            ::||....|      .|..:.|...|.:..||  .|.|  ::...:.|.  .|:|.|.   |..|
 Worm   133 LDKYLSEQE------TKFLISDDVTHIDCLVLTRLHSI--RVAAKMLKN--YEIPADLSHVLDYL 187

  Fly   136 KDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSA 188
            |..|| .|.|....|         :|..||     ||.:    :....|:|||
 Worm   188 KAGYA-TEMFRVSCP---------SDQEIV-----LHWT----ELKDTPRLSA 221

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 31/118 (26%)