Sequence 1: | NP_001286570.1 | Gene: | GstE10 / 37105 | FlyBaseID: | FBgn0063499 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 58/207 - (28%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 18/207 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGE------ 62
Fly 63 -SCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQL--QRALFKENA 124
Fly 125 TEVPKDRLAELKDAYALL-----EQFLAENPYVAGPQLTIAD-FSIVATVSTLHLSYCPVDATKY 183
Fly 184 PKLSAWLARISA 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE10 | NP_001286570.1 | GstA | 4..197 | CDD:223698 | 58/207 (28%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 24/79 (30%) | ||
GST_C_Delta_Epsilon | 91..211 | CDD:198287 | 28/113 (25%) | ||
Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 24/81 (30%) |
GST_C_Theta | 98..223 | CDD:198292 | 28/112 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844533 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100130 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.650 |