DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gstm6

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001366433.1 Gene:Gstm6 / 14867 MGIID:1309467 Length:253 Species:Mus musculus


Alignment Length:161 Identity:47/161 - (29%)
Similarity:73/161 - (45%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRL 100
            |..|.|:...|    :|.|.||...:..|:||:.||..|:    ...:|....|.|::.|:|.|:
Mouse    84 DKFKLDLDFPN----LPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRI 144

  Fly   101 HFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIV 165
              :.|:|.:.       |.|::...|.    |..|.|...|..:||.:.|:.||.::|.||| :|
Mouse   145 --QMGMLCYS-------ADFEKRKPEF----LKGLPDQLKLYSEFLGKQPWFAGDKITFADF-LV 195

  Fly   166 ATVSTLHLSYCPVDATKYPKLSAWLARISAL 196
            ..|...|..:.|.....:|.|..::||...|
Mouse   196 YDVLDQHRMFEPTCLDAFPNLKDFMARFEGL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 47/161 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 13/36 (36%)
GST_C_Delta_Epsilon 91..211 CDD:198287 31/106 (29%)
Gstm6NP_001366433.1 GST_C_family <10..47 CDD:413470
GST_N_Mu 48..119 CDD:239373 13/38 (34%)
GST_C_Mu 127..247 CDD:198318 33/114 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.