DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gstm3

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_034489.1 Gene:Gstm3 / 14864 MGIID:106026 Length:218 Species:Mus musculus


Alignment Length:146 Identity:35/146 - (23%)
Similarity:60/146 - (41%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQL 115
            :|.|.||...:..|:||:.||..|:    ...:|....|.|:..|:|.|:             ||
Mouse    60 LPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRI-------------QL 111

  Fly   116 QRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDA 180
            .......:..:...:.|..:.:...|..:||.:.|:.||.::|..|| :...:...:..:.|...
Mouse   112 MIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDF-LAYDILDQYRMFEPKCL 175

  Fly   181 TKYPKLSAWLARISAL 196
            ..:|.|..:|||...|
Mouse   176 DAFPNLRDFLARFEGL 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 35/146 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/21 (43%)
GST_C_Delta_Epsilon 91..211 CDD:198287 23/106 (22%)
Gstm3NP_034489.1 GstA 3..189 CDD:223698 34/142 (24%)
GST_N_Mu 3..84 CDD:239373 9/23 (39%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08515 7..8
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08515 46..50
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08515 59..60 35/146 (24%)