DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gstm2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_032209.1 Gene:Gstm2 / 14863 MGIID:95861 Length:218 Species:Mus musculus


Alignment Length:174 Identity:44/174 - (25%)
Similarity:73/174 - (41%) Gaps:23/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQL 115
            :|.|.||...|..|:||:.||..|:    ...:|....|.|:...:|.|:             ||
Mouse    60 LPYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQAMDTRI-------------QL 111

  Fly   116 QRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDA 180
            ....:..:..:...:.|..|.:...|..:||.:.|:.||.::|..|| :|..|...|..:.|...
Mouse   112 AMVCYSPDFEKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDF-LVYDVLDQHRIFEPKCL 175

  Fly   181 TKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKL----PK 220
            ..:|.|..::.|...|... .|.::.:|.|:..|.:|:    ||
Mouse   176 DAFPNLKDFMGRFEGLKKI-SDYMKSSRFLSKPIFAKMAFWNPK 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 36/145 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/21 (48%)
GST_C_Delta_Epsilon 91..211 CDD:198287 26/119 (22%)
Gstm2NP_032209.1 PTZ00057 3..202 CDD:173353 38/156 (24%)
GST_N_Mu 3..84 CDD:239373 10/23 (43%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08010 7..8
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08010 43..46
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P08010 59..60 44/174 (25%)