DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gdap1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_034397.1 Gene:Gdap1 / 14545 MGIID:1338002 Length:358 Species:Mus musculus


Alignment Length:244 Identity:56/244 - (22%)
Similarity:101/244 - (41%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWD 67
            :||||....|...:.|.|.:....|..|.|.:.:...:|.:|..:|.|....||:|..||:.|.:
Mouse    25 HLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICE 89

  Fly    68 SHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRL 132
            :..||.||...:.  ||..|           ||..:.|.::   :.::|.  ::|....:|    
Mouse    90 ATQIIDYLEQTFL--DERTP-----------RLMPDEGSMY---YPRVQH--YRELLDSLP---- 132

  Fly   133 AELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLS--------AW 189
               .|||.        :..:..|:||: |..|.|..:|...|......::..||:        |:
Mouse   133 ---MDAYT--------HGCILHPELTV-DSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAY 185

  Fly   190 LARISAL--PFYEEDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIKSG 236
            :|:...|  ...:.||::..:.:.|::...|.:...:|.::..|..:.|
Mouse   186 IAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 49/202 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..211 CDD:198287 24/129 (19%)
Gdap1NP_034397.1 GST_N_GDAP1 26..98 CDD:239350 23/71 (32%)
GST_C_GDAP1 179..289 CDD:198336 10/56 (18%)
Required for mitochondrial localization. /evidence=ECO:0000250 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.