DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and LOC1270342

DIOPT Version :10

Sequence 1:NP_611322.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_309027.3 Gene:LOC1270342 / 1270342 VectorBaseID:AGAMI1_014353 Length:407 Species:Anopheles gambiae


Alignment Length:32 Identity:9/32 - (28%)
Similarity:13/32 - (40%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLD 35
            |.:...:.|.|..|.:|. ...:||...|..|
Mosquito   107 LAMLECQQSRPFYASILK-ELFELDKNLHDCD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_611322.1 GST_N_Delta_Epsilon 4..77 CDD:239343 9/32 (28%)
GST_C_Delta_Epsilon 91..211 CDD:198287
LOC1270342XP_309027.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.