DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTO2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:213 Identity:48/213 - (22%)
Similarity:87/213 - (40%) Gaps:23/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPD-MLRKNPQHTVPMLEDGE-SCIWDS 68
            :|.....|......|.|:|..:.||...::::.    ||: ...|:|...:|:||..: ..|::|
Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRN----KPEWYYTKHPFGHIPVLETSQCQLIYES 86

  Fly    69 HAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLA 133
            .....||.:.| ...:|:|.||.:||  .|::..|   ||..:....:..|..........:..|
Human    87 VIACEYLDDAY-PGRKLFPYDPYERA--RQKMLLE---LFCKVPHLTKECLVALRCGRECTNLKA 145

  Fly   134 ELKDAYALLEQFL--AENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKY-PKLSAWLARISA 195
            .|:..::.||:.|  ....:..|..:::.|:.:......|.: |..:|...: |.|..|::.:..
Human   146 ALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDV-YGILDCVSHTPALRLWISAMKW 209

  Fly   196 LPFYEEDNLRGARLLADK 213
            .|..       ..||.||
Human   210 DPTV-------CALLMDK 220

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/195 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 91..211 CDD:198287 22/122 (18%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 17/71 (24%)