DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and LOC100911464

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_038967329.1 Gene:LOC100911464 / 100911464 RGDID:6492721 Length:249 Species:Rattus norvegicus


Alignment Length:157 Identity:37/157 - (23%)
Similarity:69/157 - (43%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HT-----VPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVD------QRLHFETGV 106
            ||     :|..|||:..::.|.||:.::.:.:.    ||.|...:.|:||      :.||:....
  Rat    95 HTCLYGQLPKFEDGDLTLYQSSAILRHVGHSFG----LYGKGQREAALVDMVNDGVEDLHYRYVT 155

  Fly   107 LFHGIFKQLQRALFKENA-TEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVST 170
            |.:.|:         ||. .:..|.....||....||.|......::.|.|::.|::::: .:..
  Rat   156 LIYTIY---------ENGKDDYMKALPGHLKPFETLLSQNQEGKAFIVGDQISFANYNLL-DLLL 210

  Fly   171 LHLSYCPVDATKYPKLSAWLARISALP 197
            :|          :|.|:|::..:||.|
  Rat   211 VH----------FPLLAAYVVHLSAQP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 36/155 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/28 (32%)
GST_C_Delta_Epsilon 91..211 CDD:198287 25/114 (22%)
LOC100911464XP_038967329.1 Thioredoxin_like <96..123 CDD:412351 8/26 (31%)
GST_C_family 133..249 CDD:413470 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.