DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and Chi3l1

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:440 Identity:123/440 - (27%)
Similarity:188/440 - (42%) Gaps:91/440 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LAFFQSTYAEVGKLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGIDAVTYKIKSLDP 82
            |...||..|.  ||||:|...|..|||........|:.:|  |..::|.:|.|..     ..|..
  Rat    21 LMLLQSCSAY--KLVCYYTNWSQYREGNGSCFPDALDHSL--CTHIIYSFANISN-----NKLST 76

  Fly    83 SLTNDRQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQASVLAE 147
            |..||...|..:..|:.:.|.::.||||||    .|.|   |:::.|::..::.||:|..||...
  Rat    77 SEWNDVTLYGMLNTLKTRNPRLKTLLSVGG----WSFG---SERFSRIVSNAKSRKTFVQSVAPF 134

  Fly   148 LNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQFATLLEELQSDL 212
            |...||||:||||.:|                           ..|.::|   |.||::||:::.
  Rat   135 LRTYGFDGLDLAWLYP---------------------------GPKDKQH---FTTLIKELKAEF 169

  Fly   213 RRGGQLLTVSML-------PHVSAELFIDVPKVLSNVDFVNLGTYDFQTPERDPKVADLPTPLY- 269
            .:..|..|..:|       ..|:.:...||.::..::||:||.||||....|  ......:||: 
  Rat   170 TKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWR--HTTGHHSPLFR 232

  Fly   270 AMYDRDPSH--NVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMTRNSGITGYPPIPAANGAAP 332
            ...|..|..  ||.|.|.|.:...:  ..:||.:|:.::|:::.:..:....|.|    ..|:..
  Rat   233 GQQDTGPDRFSNVDYGVGYMLRLGA--PTNKLVMGIPTFGKSFTLASSENQVGAP----ITGSGL 291

  Fly   333 PGRQTVTPGLLSWPEICDLLQQQPQDR----EVPHLRKVGDPTKRFGIYAYRAADDQGENGLWVG 393
            |||.|...|.|::.||||.|:.....|    :||...|                     ...|||
  Rat   292 PGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFATK---------------------GNQWVG 335

  Fly   394 YEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQCAGEK--FPILRSIK 441
            |:||.:...|..::..:.|.|.....:.:|||||...|..  ||:..:||
  Rat   336 YDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 119/428 (28%)
Glyco_18 30..423 CDD:214753 109/406 (27%)
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 109/406 (27%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 118/427 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.