DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and AT4G19770

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:304 Identity:68/304 - (22%)
Similarity:117/304 - (38%) Gaps:68/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LLEQSEHRKSFQASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKS 194
            :...|..||||..|.::...:.||||:||.|::|:|..::..  |..:   |:.|          
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPRNAAEMSD--FAEL---LKEW---------- 50

  Fly   195 EEHREQFATLLEELQSDLRRGGQLLTVSMLPHVSAE---LFIDVPKVLSNVDFVNLGTYDFQTPE 256
                 ::|...|...|:|    .:|.::...:.|:.   :...|..:...:|:||:..|||.   
plant    51 -----RYAVQGEAYSSEL----PVLILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFY--- 103

  Fly   257 RDPKVADLPTPLYAMYDRDPSHNVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMT--RNSG-- 317
             .|...::..|..|:|.:....:....|:.|::  :.:...|..:|...||.||.:.  :|.|  
plant   104 -GPGCTEVTGPPAALYLQSDGPSGDSGVKDWID--AGLPAEKAVLGFPYYGWAWTLADPKNHGYY 165

  Fly   318 --ITGYPPIPAANGAAPPGRQTVTPGLLSWPEICDLLQQQPQDREVPHLRKVGDPTKRFGIYAYR 380
              .||  |..:.:|.....:      |.:|  |.|.......|..|     :||       |.|.
plant   166 VDTTG--PAISDDGEISYSQ------LKTW--IVDNKATTVHDNIV-----IGD-------YCYA 208

  Fly   381 AADDQGENGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDD 424
            ..       .|:||:...:...|..:...:||.|.....:..||
plant   209 GT-------TWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 68/304 (22%)
Glyco_18 30..423 CDD:214753 66/301 (22%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 68/304 (22%)
Glyco_18 <1..244 CDD:214753 66/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.