DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and AT4G19740

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:178 Identity:43/178 - (24%)
Similarity:75/178 - (42%) Gaps:32/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RKSFQASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQF 201
            |:||.:|.::...:.||.|:||||::|.|  .::...|.::   |:.|.|:..|:.:....|...
plant     8 RESFISSSISIARSLGFYGLDLAWEYPNN--DVEMNNFGKL---LQEWRSAVEVESQRTGIRPLL 67

  Fly   202 ATLLEELQSDLRRGGQLLTVSMLPHVSAELFIDVPKVLSNVDFVNLGTYDFQ--TPERDPKVADL 264
            .|......||..      :||          ..|..:..::|:|||..|:|.  |.|..|     
plant    68 LTAAVYYTSDYN------SVS----------YPVQAINRSLDWVNLIAYEFYGLTTEIGP----- 111

  Fly   265 PTPLYAMYDRDPSHNVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNM 312
            |..||....:.|..:.  .:::|:.  :.:...|...|....|.:|.:
plant   112 PAGLYDPSIKGPCGDT--GLKHWLK--AGLPEKKAVFGFPYVGWSWTL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 43/178 (24%)
Glyco_18 30..423 CDD:214753 43/178 (24%)
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 39/163 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.