DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and Ctbs

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_112285.1 Gene:Ctbs / 81652 RGDID:621338 Length:367 Species:Rattus norvegicus


Alignment Length:337 Identity:71/337 - (21%)
Similarity:117/337 - (34%) Gaps:99/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NSEG---VADSDKYLRLLEQSEHRKSFQASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVW 178
            :|:|   |...|..|:.:.....|.|:.|..:|.......|||::         .::|       
  Rat    81 HSKGARVVLKGDVALKDIINPTFRASWIAQKVALAKAQHMDGINI---------DIEQ------- 129

  Fly   179 GSLRGWFSSSSVDEKSEEHREQFATLLEELQSDLRR---GGQL-LTVSMLPHVSAELFIDVPKVL 239
                      .||..|.|: |....|:.|......|   |.|: ..|:..|....:...:...:.
  Rat   130 ----------EVDCSSPEY-EALTALVRETTEGFHREIEGSQVTFDVAWSPKGIDKRCYNYTGIA 183

  Fly   240 SNVDFVNLGTYDFQTPERDPKVADLPTPLYAMYDRDPSHNVQYQVQYWMNQT---------SEIS 295
            ...||:.:.:||.|:......:|              :.|..|      |||         ..||
  Rat   184 DACDFLFVMSYDEQSQIWSECIA--------------AANAPY------NQTLTGYGDYLRMGIS 228

  Fly   296 VHKLHVGVTSYGRAW---NMTRNS--GITGYP----PIPAANGAAPPGR---QTVTPGLLSWPEI 348
            ..||.:|:..||..:   |::::.  .|...|    |...|.|...|.|   :.|...:..    
  Rat   229 PRKLVMGIPWYGYDYICLNLSKDDVCAIAKVPFRGAPCSDAAGHQVPYRVIMKQVNSSVSG---- 289

  Fly   349 CDLLQQQPQDREVPHLRKVGDPTKRFGIYAYRAADDQGENGLWVGYEDPLTAAIKAGFVHAQGLG 413
                .|..||::.|:. ...|||.|.             :.:|  |::|.:.::||.||...||.
  Rat   290 ----SQWNQDQQAPYY-NYKDPTGRL-------------HQVW--YDNPRSISLKAAFVKHYGLR 334

  Fly   414 GVAFHDLSMDDF 425
            |:...:.:..|:
  Rat   335 GIGMWNANCLDY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 71/337 (21%)
Glyco_18 30..423 CDD:214753 70/333 (21%)
CtbsNP_112285.1 GH18_chitobiase 23..363 CDD:119354 71/337 (21%)
Glyco_18 <100..343 CDD:214753 65/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.