DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and chia.3

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_998378.1 Gene:chia.3 / 406819 ZFINID:ZDB-GENE-040426-2891 Length:471 Species:Danio rerio


Alignment Length:458 Identity:117/458 - (25%)
Similarity:196/458 - (42%) Gaps:111/458 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLLCSFLAFFQSTYAEVGKLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGI---- 70
            |.|:|| .:||..       ::.|::...|..|.|..:.:.|.::|.|  |..|:|.::.|    
Zfish    10 LSLVLC-HVAFSM-------EMACYFTNWSQYRPGIGKYTPANVDPYL--CTHLIYAFSIINQRN 64

  Fly    71 DAVTYKIKSLDPSLTNDRQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSE 135
            :.|||:        .||...|:....|:.|.|.::.||:|||..       ..|.::..::....
Zfish    65 ELVTYE--------WNDETLYKAFNELKNKNPTLKTLLAVGGWN-------FGSAQFSIMVSNPA 114

  Fly   136 HRKSFQASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQ 200
            :||:|..|.:..|..:||||:||.|::|..|            ||             ..|.:::
Zfish   115 NRKTFIQSTIKFLRTHGFDGLDLDWEYPGAR------------GS-------------PPEDKQR 154

  Fly   201 FATLLEEL----QSDLRRGGQ---LLTVSMLPHVSA-----ELFIDVPKVLSNVDFVNLGTYDFQ 253
            |..|.:||    :::.:..|.   :||.:    |||     :...::.::...::|:|:.||||.
Zfish   155 FTLLCKELVAAYEAESKATGNPQLMLTAA----VSAGKGTIDDGYEIAEIAKYLNFINVMTYDFH 215

  Fly   254 -TPERDPKVADLPTPLYAMYDRDPS----HNVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMT 313
             |.||   .....:||| ...:|..    .|..|.::||.:..:  .|.||.:|..:|||.:.:|
Zfish   216 GTWER---FTGHNSPLY-QGSKDEGDLIYFNTDYAMRYWRDNGT--PVEKLRMGFAAYGRTFRLT 274

  Fly   314 RNSGITGYPPIPAANGAAPPGRQTVTPGLLSWPEICDLLQ----QQPQDREVPHLRKVGDPTKRF 374
            .:....|.|    |:|.|..|..|...|..|:.|||..|:    |...|::||:..|        
Zfish   275 SSDTSVGAP----ASGPASAGTYTREAGFWSYYEICGFLEGTTIQWIDDQKVPYATK-------- 327

  Fly   375 GIYAYRAADDQGENGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQ-CAGEKFPILR 438
                         |..|||::...:...|..::..:..||.....|.:|||.|| |:....|::.
Zfish   328 -------------NSEWVGFDTKESYETKVRYLKDKNFGGAFVWALDLDDFAGQFCSQGNHPLMA 379

  Fly   439 SIK 441
            .::
Zfish   380 HLR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 111/438 (25%)
Glyco_18 30..423 CDD:214753 104/417 (25%)
chia.3NP_998378.1 Glyco_18 24..363 CDD:214753 104/415 (25%)
GH18_chitolectin_chitotriosidase 25..385 CDD:119351 111/435 (26%)
ChtBD2 421..469 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.