DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and btb-18

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_872066.2 Gene:btb-18 / 353391 WormBaseID:WBGene00018201 Length:298 Species:Caenorhabditis elegans


Alignment Length:87 Identity:24/87 - (27%)
Similarity:37/87 - (42%) Gaps:18/87 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DPSLTNDRQHYRHITALRKKY------PHVRFLLSVGGDRDVNSEGVADSDKY--LRLLEQS--- 134
            :|...|||. ...|..|..::      .||...| :...|..|...:..:|||  .:||:.|   
 Worm   201 NPVFPNDRS-VEKILVLADRFKVQSAIDHVEHHL-LHNSRLANECMMWMADKYGMKKLLKISIQN 263

  Fly   135 ----EHRKSFQASVL-AELNNN 151
                |:.|:.:.|.| |.|::|
 Worm   264 IGSLENAKNLKNSTLFASLSHN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 24/87 (28%)
Glyco_18 30..423 CDD:214753 24/87 (28%)
btb-18NP_872066.2 BTB 141..237 CDD:197585 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.