DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and CG8460

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:96/249 - (38%) Gaps:76/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YD-AQSFVRE----GPAQMSLAELEPALQFCNFLVYGYAGIDAVTYKIKSLDPSLTNDRQHYRHI 94
            || |:.|.::    .|..:.:.:     |...:.|.|...|||         ..||:.|:..:.:
  Fly    97 YDVAKIFAKKFDIISPVWLQIVK-----QGDRYAVAGTHDIDA---------GWLTDVRRKGKQV 147

  Fly    95 TALR--KKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQASVLAELNNNGFDGID 157
            ...|  |.:|  ||:.....|||:.           .||..::.|......::....:|||||:.
  Fly   148 HNQRTVKVFP--RFIFDHFTDRDIK-----------LLLSDAQERTKVNDVLIKCCKDNGFDGLV 199

  Fly   158 LAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQFATLLEELQSDLRRGGQLLTVS 222
            |                 .||..|.|     .:|:|.      ..||:.::..:|:: .||..:.
  Fly   200 L-----------------EVWSQLAG-----RIDDKI------LYTLVLQMAKELQK-QQLRLIL 235

  Fly   223 MLP-------HVSAELFIDVPKVLSNVDFVNLGTYDFQTPERDPKVADLPTPLY 269
            ::|       |:..|..:|  |:..::...:|.||||.:.:|....|    |||
  Fly   236 VIPPFRKETGHLFGEKHMD--KLFKHIYAFSLMTYDFSSVQRPGANA----PLY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 57/249 (23%)
Glyco_18 30..423 CDD:214753 57/249 (23%)
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 57/249 (23%)
Glyco_18 86..393 CDD:214753 57/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.