DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf5 and si:ch211-226m16.2

DIOPT Version :9

Sequence 1:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001191302.1 Gene:si:ch211-226m16.2 / 100003708 ZFINID:ZDB-GENE-030131-2302 Length:410 Species:Danio rerio


Alignment Length:225 Identity:48/225 - (21%)
Similarity:83/225 - (36%) Gaps:55/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SFLAFFQSTYAE--VGKLVCFYDAQS-FVREGPAQMSLAELEPALQFCNFLVYGYAGIDAVTYKI 77
            :||....|..|:  ..:|.|:.|..: ..|||.              |..::......|...|. 
Zfish     8 AFLCLVVSVGAQRTQSRLSCYLDVLTPHTREGS--------------CTHIILPSVSSDDELYL- 57

  Fly    78 KSLDPSLTNDRQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHR-KSFQ 141
                .|||.:  .|..|..::::...::.||           |:......|:|:..:|.. .||.
Zfish    58 ----QSLTEN--EYDAIQRMKERNSALKILL-----------GLEIKSSRLKLMSANEASVGSFI 105

  Fly   142 ASVLAELNNNGFDGIDLAW--QFPKNRP------KLQQGVFKRVWGSLRGWFSSSSVDEKS---- 194
            .::|..|.....||:|:.|  ..|.:..      |..:|||:.   .:|....|:||.|.:    
Zfish   106 QTLLTYLKEKRLDGLDVIWLDGTPSDTELFTDFLKSIKGVFEE---EMRPLLLSASVKEPTDKTV 167

  Fly   195 ----EEHREQFATLLEELQSDLRRGGQLLT 220
                |:...|:...:..|.:.|:..||.::
Zfish   168 ASYDEQILSQYVDFISILPAQLQTDGQYIS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 44/209 (21%)
Glyco_18 30..423 CDD:214753 44/209 (21%)
si:ch211-226m16.2NP_001191302.1 GH18_chitinase-like 41..>185 CDD:324582 34/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.