DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BomS4 and BomS1

DIOPT Version :9

Sequence 1:NP_663309.1 Gene:BomS4 / 37101 FlyBaseID:FBgn0034330 Length:45 Species:Drosophila melanogaster
Sequence 2:NP_611319.1 Gene:BomS1 / 37100 FlyBaseID:FBgn0034329 Length:45 Species:Drosophila melanogaster


Alignment Length:45 Identity:37/45 - (82%)
Similarity:42/45 - (93%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK 45
            |:||::||||||||||:|||:|||||||||||||||..|||.|||
  Fly     1 MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNVHGGK 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BomS4NP_663309.1 DIM 1..40 CDD:285413 31/38 (82%)
BomS1NP_611319.1 DIM 1..40 CDD:285413 31/38 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009983
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.