DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BomS4 and BomS1

DIOPT Version :10

Sequence 1:NP_663309.1 Gene:BomS4 / 37101 FlyBaseID:FBgn0034330 Length:45 Species:Drosophila melanogaster
Sequence 2:NP_611319.1 Gene:BomS1 / 37100 FlyBaseID:FBgn0034329 Length:45 Species:Drosophila melanogaster


Alignment Length:45 Identity:37/45 - (82%)
Similarity:42/45 - (93%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK 45
            |:||::||||||||||:|||:|||||||||||||||..|||.|||
  Fly     1 MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNVHGGK 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BomS4NP_663309.1 DIM 1..40 CDD:400485 31/38 (82%)
BomS1NP_611319.1 DIM 1..40 CDD:400485 31/38 (82%)

Return to query results.
Submit another query.