powered by:
Protein Alignment BomS1 and BomS4
DIOPT Version :9
Sequence 1: | NP_611319.1 |
Gene: | BomS1 / 37100 |
FlyBaseID: | FBgn0034329 |
Length: | 45 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_663309.1 |
Gene: | BomS4 / 37101 |
FlyBaseID: | FBgn0034330 |
Length: | 45 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 37/45 - (82%) |
Similarity: | 42/45 - (93%) |
Gaps: | 0/45 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNVHGGK 45
|:||::||||||||||:|||:|||||||||||||||..|||.|||
Fly 1 MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK 45
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
BomS1 | NP_611319.1 |
DIM |
1..40 |
CDD:285413 |
31/38 (82%) |
BomS4 | NP_663309.1 |
DIM |
1..40 |
CDD:285413 |
31/38 (82%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45447469 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0009983 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.