DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14505 and Gskip

DIOPT Version :10

Sequence 1:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_848728.2 Gene:Gskip / 66787 MGIID:1914037 Length:144 Species:Mus musculus


Alignment Length:91 Identity:35/91 - (38%)
Similarity:54/91 - (59%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSYEFDDVADEVA 80
            ||:.:|:......:|:.|::.:|....|||||:.|.|:..||::|:.||.|:|.|.||.|.|.: 
Mouse    41 EAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHL- 104

  Fly    81 NCDTVY-ESAHQLLAGISPLYGEKYG 105
              .|.| |:.:.||..:||.|.|.:|
Mouse   105 --QTPYHETVYSLLDTLSPAYREAFG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14505NP_001036558.1 GSKIP_dom 15..116 CDD:398795 35/91 (38%)
GskipNP_848728.2 GSKIP_dom 38..138 CDD:398795 35/91 (38%)

Return to query results.
Submit another query.