DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14505 and GSKIP

DIOPT Version :9

Sequence 1:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001258833.1 Gene:GSKIP / 51527 HGNCID:20343 Length:139 Species:Homo sapiens


Alignment Length:91 Identity:33/91 - (36%)
Similarity:53/91 - (58%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSYEFDDVADEVA 80
            ||:.:|:......:::.|::.|.....|||||:.|.|:..||::|:.||.::|.|.||.|.|.: 
Human    36 EAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHL- 99

  Fly    81 NCDTVY-ESAHQLLAGISPLYGEKYG 105
              .|.| |:.:.||..:||.|.|.:|
Human   100 --QTPYHETVYSLLDTLSPAYREAFG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14505NP_001036558.1 DUF727 15..116 CDD:283065 33/91 (36%)
GSKIPNP_001258833.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
DUF727 33..133 CDD:398795 33/91 (36%)
Required for PRKAR2A interaction, contributes to a protective effect against H(2)O(2)-induced apoptosis. /evidence=ECO:0000269|PubMed:25920809 41..45 1/3 (33%)
Interaction with GSK3B and acts as GSK3B inhibitor. /evidence=ECO:0000269|PubMed:16981698 115..139 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3965
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.