Sequence 1: | NP_001036558.1 | Gene: | CG14505 / 37098 | FlyBaseID: | FBgn0034327 | Length: | 119 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258833.1 | Gene: | GSKIP / 51527 | HGNCID: | 20343 | Length: | 139 | Species: | Homo sapiens |
Alignment Length: | 91 | Identity: | 33/91 - (36%) |
---|---|---|---|
Similarity: | 53/91 - (58%) | Gaps: | 4/91 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 EAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSYEFDDVADEVA 80
Fly 81 NCDTVY-ESAHQLLAGISPLYGEKYG 105 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14505 | NP_001036558.1 | DUF727 | 15..116 | CDD:283065 | 33/91 (36%) |
GSKIP | NP_001258833.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
DUF727 | 33..133 | CDD:398795 | 33/91 (36%) | ||
Required for PRKAR2A interaction, contributes to a protective effect against H(2)O(2)-induced apoptosis. /evidence=ECO:0000269|PubMed:25920809 | 41..45 | 1/3 (33%) | |||
Interaction with GSK3B and acts as GSK3B inhibitor. /evidence=ECO:0000269|PubMed:16981698 | 115..139 | 5/9 (56%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155508 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3965 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1508955at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0005233 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_107811 | |
Panther | 1 | 1.100 | - | - | O | PTHR12490 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3011 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.740 |