DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14505 and Gskip

DIOPT Version :9

Sequence 1:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001014220.2 Gene:Gskip / 362778 RGDID:1308470 Length:144 Species:Rattus norvegicus


Alignment Length:91 Identity:35/91 - (38%)
Similarity:54/91 - (59%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSYEFDDVADEVA 80
            ||:.:|:......:::.|::.||....|||||:.|.|:..||::|:.||.|:|.|.||.|.|.: 
  Rat    41 EAEAVVNDVLFAVNNMFVSKSLPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHL- 104

  Fly    81 NCDTVY-ESAHQLLAGISPLYGEKYG 105
              .|.| |:.:.||..:||.|.|.:|
  Rat   105 --QTPYHETVYSLLDTLSPAYREAFG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14505NP_001036558.1 DUF727 15..116 CDD:283065 35/91 (38%)
GskipNP_001014220.2 DUF727 38..138 CDD:398795 35/91 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349392
Domainoid 1 1.000 64 1.000 Domainoid score I9969
eggNOG 1 0.900 - - E1_KOG3965
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 1 1.000 - - oto96471
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.