DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14505 and C06A12.3

DIOPT Version :9

Sequence 1:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001255953.1 Gene:C06A12.3 / 178529 WormBaseID:WBGene00007357 Length:253 Species:Caenorhabditis elegans


Alignment Length:109 Identity:26/109 - (23%)
Similarity:51/109 - (46%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVQSDEN----DFHALREAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRA 63
            ::.||::    :..|:.....:....||.:    |:|.||....:.::|::|.|...|.::|:..
 Worm   132 VIPSDDDVGPLELEAIAAVHELAHEVQDIS----VSEMLPRTSDLIFVNVKTQEGSPYTLELTMK 192

  Fly    64 GYRIVSYEFDDVADEVANCD---TVYESAHQLLAGISPLYGEKY 104
            |:||.|...|.:..:.....   ..|.:|.:||..|||.:..::
 Worm   193 GWRIASSHTDCMNGDYTKISLHTKYYRNARELLKFISPDHATRF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14505NP_001036558.1 DUF727 15..116 CDD:283065 23/93 (25%)
C06A12.3NP_001255953.1 DUF727 142..247 CDD:368379 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.