DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14505 and T24H7.3

DIOPT Version :9

Sequence 1:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_495248.1 Gene:T24H7.3 / 174032 WormBaseID:WBGene00020782 Length:156 Species:Caenorhabditis elegans


Alignment Length:103 Identity:34/103 - (33%)
Similarity:53/103 - (51%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DENDFHALREAQRMVDSCQDFADHLI-VAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSY 70
            :|....|:||        ..||.:|| |:|.||....:.:||:.|.|...:|::|::.|:|:.|.
 Worm    43 EEEAMAAVRE--------NAFAVNLIGVSEMLPRTSQLLFINVTTFENHTHCIELTQKGWRVASN 99

  Fly    71 EFDDVADEVANCD---TVYESAHQLLAGISPLYGEKYG 105
            ..|.:..:....|   ..:||.|.||..||||:.|.:|
 Worm   100 RNDCMNGDFRQLDIHTKYFESLHTLLMDISPLFRETFG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14505NP_001036558.1 DUF727 15..116 CDD:283065 32/95 (34%)
T24H7.3NP_495248.1 DUF727 42..147 CDD:368379 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3965
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 1 1.000 - - oto18315
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.